Yuvi yuvi | 2 Mar 2012 11:31
Picon

Getting undefined reference to 'clock_getTime' error..

Hi,

Gretings,

I have cross compile, OpenSSl , libssh2 and finally cURL, Don't know why it has generated only static library. Anyway I tried to run sample ftpget.c program by linking all the three libraries but I am getting the following error :

.../libcurl.a(timeval.o): In function 'curlx_tvnow':
timeval.c:(.text+0xfc): undefined reference to 'clock_gettime'
collect2: ld return  1 exit status
make: *** [all] Error 1

 Please help me resolve this error, Is there need to cross-compile any other library also ?

Thanks,
Yuvi


-------------------------------------------------------------------
List admin: http://cool.haxx.se/list/listinfo/curl-users
FAQ:        http://curl.haxx.se/docs/faq.html
Etiquette:  http://curl.haxx.se/mail/etiquette.html
Dan Fandrich | 2 Mar 2012 15:48
Favicon

Re: Getting undefined reference to 'clock_getTime' error..

On Fri, Mar 02, 2012 at 04:01:59PM +0530, Yuvi yuvi wrote:
> I have cross compile, OpenSSl , libssh2 and finally cURL, Don't know why it has
> generated only static library. Anyway I tried to run sample ftpget.c program by
> linking all the three libraries but I am getting the following error :
> 
> .../libcurl.a(timeval.o): In function 'curlx_tvnow':
> timeval.c:(.text+0xfc): undefined reference to 'clock_gettime'
> collect2: ld return  1 exit status
> make: *** [all] Error 1
> 
>  Please help me resolve this error, Is there need to cross-compile any other
> library also ?

How did you link the app? If you use the flags from
'curl-config --static-libs' then you shouldn't have any problems
linking. You're probably missing -lrt.

>>> Dan

-------------------------------------------------------------------
List admin: http://cool.haxx.se/list/listinfo/curl-users
FAQ:        http://curl.haxx.se/docs/faq.html
Etiquette:  http://curl.haxx.se/mail/etiquette.html

Michael B. Klein | 3 Mar 2012 00:13
Picon

Forcing curl to use gssapi

Hi all,


I've compiled curl with both libssl2 and gssapi support, but I can't seem to get curl to attempt gssapi authentication.

Here's my (verbose) output:

dn0a20734e:lyber-core mbklein$ curl-ssh --verbose sftp://myuser <at> myserver/var/opt/home/myuser/testfile.txt
* About to connect() to myserver port 22 (#0)
*   Trying [ip address]...
* connected
* Connected to myserver ([ip address]) port 22 (#0)
* SSH MD5 fingerprint: [redacted]
* SSH host check: 0, key: [redacted]
* SSH authentication methods available: publickey,gssapi-with-mic,password
* Using ssh public key file /Users/mbklein/.ssh/id_dsa.pub
* Using ssh private key file /Users/mbklein/.ssh/id_dsa
* SSH public key authentication failed: Username/PublicKey combination invalid
* Authentication failure
* Closing connection #0
curl: (67) Authentication failure

And here's my build info:

curl 7.24.0 (x86_64-apple-darwin11.3.0) libcurl/7.24.0 OpenSSL/0.9.8r zlib/1.2.5 libidn/1.22 libssh2/1.3.0
Protocols: dict file ftp ftps gopher http https imap imaps ldap ldaps pop3 pop3s rtsp scp sftp smtp smtps telnet tftp 
Features: GSS-Negotiate IDN IPv6 Largefile NTLM NTLM_WB SSL libz 

It doesn't seem to be attempting gssapi-with-mic (or password) negotiation after publickey auth fails. I've tried using "--krb private" and "--negotiate" and various values to "-u" but I get the same output every time.

Am I doing something wrong, or is SFTP+GSSAPI/Kerberos simply not a supported protocol/auth combination?

Thanks,
Michael
-------------------------------------------------------------------
List admin: http://cool.haxx.se/list/listinfo/curl-users
FAQ:        http://curl.haxx.se/docs/faq.html
Etiquette:  http://curl.haxx.se/mail/etiquette.html
Shane Neeley | 3 Mar 2012 20:01
Picon

Biologist new to cURL. Question about interacting with a form.

Hi,

Please bare with me, I am new to both cURL and HTML. I have an interesting problem and I would like to be able to use cURL to solve it. I am trying to access a server located here: 

http://consurf.tau.ac.il/index_full_form_PROT.php

I will write a python program that will use cURL to add text to the box that says "Paste protein sequence here"
Then all I need to do is press the submit button at the bottom. I am trying to automate this process over thousands of files and I heard that cURL might be a great way to do it. 

Here would be an example of the FASTA format in quotes that it is talking about.
">
DGVGSSSGNWHCDSTWLGDRVITTSTRTWALPTYNNHLYKQISNGTSGGATNDNTYFGYST"

Could somebody please show me how I could fill out that form using cURL in my terminal? Thank you sincerely.

Shane.
-------------------------------------------------------------------
List admin: http://cool.haxx.se/list/listinfo/curl-users
FAQ:        http://curl.haxx.se/docs/faq.html
Etiquette:  http://curl.haxx.se/mail/etiquette.html
Shane Neeley | 3 Mar 2012 20:41
Picon

Re: Biologist new to cURL. Question about interacting with a form.

Hi,


These are the HTTP headers generated when I perform my job that I have described in the previous email. Do you see how the pasting of FASTA sequence (In Red) could be callable on cURL so that I could do it over multiple FASTA sequence files?

__________________________________________________________________________________________


POST /cgi-bin/new_consurf.cgi HTTP/1.1
User-Agent: Mozilla/5.0 (Macintosh; U; Intel Mac OS X 10.7; en-US; rv:1.9.2.27) Gecko/20120216 Firefox/3.6.27
Accept: text/html,application/xhtml+xml,application/xml;q=0.9,*/*;q=0.8
Accept-Language: en-us,en;q=0.5
Accept-Encoding: gzip,deflate
Accept-Charset: ISO-8859-1,utf-8;q=0.7,*;q=0.7
Keep-Alive: 115
Connection: keep-alive
Cookie: __utma=128144414.851853261.1330802995.1330802995.1330802995.1; __utmb=128144414.3.10.1330802995; __utmc=128144414; __utmz=128144414.1330802995.1.1.utmcsr=google|utmccn=(organic)|utmcmd=organic|utmctr=consurf
Content-Type: multipart/form-data; boundary=---------------------------168072824752491622650073
Content-Length: 2301
-----------------------------168072824752491622650073
Content-Disposition: form-data; name="Run_Number"

NONE
-----------------------------168072824752491622650073
Content-Disposition: form-data; name="MAX_FILE_SIZE"

2000000
-----------------------------168072824752491622650073
Content-Disposition: form-data; name="PDB_yes_no"

no
-----------------------------168072824752491622650073
Content-Disposition: form-data; name="MSA_yes_no"

no
-----------------------------168072824752491622650073
Content-Disposition: form-data; name="FASTA_text"

>
DGVGSSSGNWHCDSTWLGDRVITTSTRTWALPTYNNHLYKQISNGTSGGATNDNTYFGYST
-----------------------------168072824752491622650073
Content-Disposition: form-data; name="MSAprogram"

MAFFT
-----------------------------168072824752491622650073
Content-Disposition: form-data; name="proteins_DB"

UNIREF90
-----------------------------168072824752491622650073
Content-Disposition: form-data; name="MAX_NUM_HOMOL"

150
-----------------------------168072824752491622650073
Content-Disposition: form-data; name="MAX_REDUNDANCY"

95
-----------------------------168072824752491622650073
Content-Disposition: form-data; name="MIN_IDENTITY"

35
-----------------------------168072824752491622650073
Content-Disposition: form-data; name="ITERATIONS"

1
-----------------------------168072824752491622650073
Content-Disposition: form-data; name="E_VALUE"

0.0001
-----------------------------168072824752491622650073
Content-Disposition: form-data; name="Homolog_search_algorithm"

BLAST
-----------------------------168072824752491622650073
Content-Disposition: form-data; name="ALGORITHM"

Bayes
-----------------------------168072824752491622650073
Content-Disposition: form-data; name="SUB_MATRIX"

JTT
-----------------------------168072824752491622650073
Content-Disposition: form-data; name="JOB_TITLE"


-----------------------------168072824752491622650073
Content-Disposition: form-data; name="user_email"


-----------------------------168072824752491622650073
Content-Disposition: form-data; name="send_user_mail"

yes
-----------------------------168072824752491622650073
Content-Disposition: form-data; name="submitForm"

Submit
-----------------------------168072824752491622650073--

HTTP/1.1 302 Found
Date: Sat, 03 Mar 2012 19:31:39 GMT
Server: Apache/2.2.8 (EL)
Content-Length: 238
Connection: close
Content-Type: text/html; charset=iso-8859-1
----------------------------------------------------------

GET /results/1330803099/output.php HTTP/1.1
User-Agent: Mozilla/5.0 (Macintosh; U; Intel Mac OS X 10.7; en-US; rv:1.9.2.27) Gecko/20120216 Firefox/3.6.27
Accept: text/html,application/xhtml+xml,application/xml;q=0.9,*/*;q=0.8
Accept-Language: en-us,en;q=0.5
Accept-Encoding: gzip,deflate
Accept-Charset: ISO-8859-1,utf-8;q=0.7,*;q=0.7
Keep-Alive: 115
Connection: keep-alive
Cookie: __utma=128144414.851853261.1330802995.1330802995.1330802995.1; __utmb=128144414.3.10.1330802995; __utmc=128144414; __utmz=128144414.1330802995.1.1.utmcsr=google|utmccn=(organic)|utmcmd=organic|utmctr=consurf

HTTP/1.1 200 OK
Date: Sat, 03 Mar 2012 19:31:41 GMT
Server: Apache/2.2.8 (EL)
X-Powered-By: PHP/5.1.6
Content-Length: 4123
Connection: close
Content-Type: text/html; charset=UTF-8
----------------------------------------------------------

GET /__utm.gif?utmwv=5.2.5&utms=4&utmn=1200564064&utmhn=consurf.tau.ac.il&utmcs=UTF-8&utmsr=1280x800&utmvp=994x637&utmsc=24-bit&utmul=en-us&utmje=1&utmfl=10.3%20r183&utmdt=ConSurf%20run%20no.%201330803099%20no%20PDB&utmhid=1772989055&utmr=0&utmp=%2Fresults%2F1330803099%2Foutput.php&utmac=UA-12265767-3&utmcc=__utma%3D128144414.851853261.1330802995.1330802995.1330802995.1%3B%2B__utmz%3D128144414.1330802995.1.1.utmcsr%3Dgoogle%7Cutmccn%3D(organic)%7Cutmcmd%3Dorganic%7Cutmctr%3Dconsurf%3B&utmu=D~ HTTP/1.1
User-Agent: Mozilla/5.0 (Macintosh; U; Intel Mac OS X 10.7; en-US; rv:1.9.2.27) Gecko/20120216 Firefox/3.6.27
Accept: image/png,image/*;q=0.8,*/*;q=0.5
Accept-Language: en-us,en;q=0.5
Accept-Encoding: gzip,deflate
Accept-Charset: ISO-8859-1,utf-8;q=0.7,*;q=0.7
Keep-Alive: 115
Connection: keep-alive

HTTP/1.1 200 OK
Date: Thu, 01 Mar 2012 23:42:00 GMT
Content-Length: 35
X-Content-Type-Options: nosniff
Pragma: no-cache
Expires: Wed, 19 Apr 2000 11:43:00 GMT
Last-Modified: Wed, 21 Jan 2004 19:51:30 GMT
Content-Type: image/gif
Cache-Control: private, no-cache, no-cache=Set-Cookie, proxy-revalidate
Age: 157781
Server: GFE/2.0
----------------------------------------------------------

GET /results/1330803099/output.php HTTP/1.1
User-Agent: Mozilla/5.0 (Macintosh; U; Intel Mac OS X 10.7; en-US; rv:1.9.2.27) Gecko/20120216 Firefox/3.6.27
Accept: text/html,application/xhtml+xml,application/xml;q=0.9,*/*;q=0.8
Accept-Language: en-us,en;q=0.5
Accept-Encoding: gzip,deflate
Accept-Charset: ISO-8859-1,utf-8;q=0.7,*;q=0.7
Keep-Alive: 115
Connection: keep-alive
Cookie: __utma=128144414.851853261.1330802995.1330802995.1330802995.1; __utmb=128144414.4.10.1330802995; __utmc=128144414; __utmz=128144414.1330802995.1.1.utmcsr=google|utmccn=(organic)|utmcmd=organic|utmctr=consurf
Cache-Control: max-age=0

HTTP/1.1 200 OK
Date: Sat, 03 Mar 2012 19:32:11 GMT
Server: Apache/2.2.8 (EL)
X-Powered-By: PHP/5.1.6
Connection: close
Transfer-Encoding: chunked
Content-Type: text/html; charset=UTF-8
----------------------------------------------------------

GET /javascript_functions.js HTTP/1.1
User-Agent: Mozilla/5.0 (Macintosh; U; Intel Mac OS X 10.7; en-US; rv:1.9.2.27) Gecko/20120216 Firefox/3.6.27
Accept: */*
Accept-Language: en-us,en;q=0.5
Accept-Encoding: gzip,deflate
Accept-Charset: ISO-8859-1,utf-8;q=0.7,*;q=0.7
Keep-Alive: 115
Connection: keep-alive
Cookie: __utma=128144414.851853261.1330802995.1330802995.1330802995.1; __utmb=128144414.4.10.1330802995; __utmc=128144414; __utmz=128144414.1330802995.1.1.utmcsr=google|utmccn=(organic)|utmcmd=organic|utmctr=consurf
If-Modified-Since: Wed, 25 Jan 2012 10:51:11 GMT
If-None-Match: "68073-4d74-4b7580aada5c0"
Cache-Control: max-age=0

HTTP/1.1 304 Not Modified
Date: Sat, 03 Mar 2012 19:32:12 GMT
Server: Apache/2.2.8 (EL)
Connection: close
Etag: "68073-4d74-4b7580aada5c0"
----------------------------------------------------------

GET /text_8_7.css HTTP/1.1
User-Agent: Mozilla/5.0 (Macintosh; U; Intel Mac OS X 10.7; en-US; rv:1.9.2.27) Gecko/20120216 Firefox/3.6.27
Accept: text/css,*/*;q=0.1
Accept-Language: en-us,en;q=0.5
Accept-Encoding: gzip,deflate
Accept-Charset: ISO-8859-1,utf-8;q=0.7,*;q=0.7
Keep-Alive: 115
Connection: keep-alive
Cookie: __utma=128144414.851853261.1330802995.1330802995.1330802995.1; __utmb=128144414.4.10.1330802995; __utmc=128144414; __utmz=128144414.1330802995.1.1.utmcsr=google|utmccn=(organic)|utmcmd=organic|utmctr=consurf
If-Modified-Since: Wed, 25 Jan 2012 10:51:13 GMT
If-None-Match: "680d7-f19-4b7580acc2a40"
Cache-Control: max-age=0

HTTP/1.1 304 Not Modified
Date: Sat, 03 Mar 2012 19:32:12 GMT
Server: Apache/2.2.8 (EL)
Connection: close
Etag: "680d7-f19-4b7580acc2a40"
----------------------------------------------------------

GET /ga.js HTTP/1.1
User-Agent: Mozilla/5.0 (Macintosh; U; Intel Mac OS X 10.7; en-US; rv:1.9.2.27) Gecko/20120216 Firefox/3.6.27
Accept: */*
Accept-Language: en-us,en;q=0.5
Accept-Encoding: gzip,deflate
Accept-Charset: ISO-8859-1,utf-8;q=0.7,*;q=0.7
Keep-Alive: 115
Connection: keep-alive
If-Modified-Since: Thu, 16 Feb 2012 00:48:45 GMT
Cache-Control: max-age=0

HTTP/1.1 304 Not Modified
Date: Sat, 03 Mar 2012 17:42:01 GMT
Expires: Sat, 03 Mar 2012 19:42:01 GMT
Age: 6611
Server: GFE/2.0
----------------------------------------------------------

GET /__utm.gif?utmwv=5.2.5&utms=5&utmn=522809432&utmhn=consurf.tau.ac.il&utmcs=UTF-8&utmsr=1280x800&utmvp=994x637&utmsc=24-bit&utmul=en-us&utmje=1&utmfl=10.3%20r183&utmdt=ConSurf%20run%20no.%201330803099%20no%20PDB&utmhid=74642245&utmr=-&utmp=%2Fresults%2F1330803099%2Foutput.php&utmac=UA-12265767-3&utmcc=__utma%3D128144414.851853261.1330802995.1330802995.1330802995.1%3B%2B__utmz%3D128144414.1330802995.1.1.utmcsr%3Dgoogle%7Cutmccn%3D(organic)%7Cutmcmd%3Dorganic%7Cutmctr%3Dconsurf%3B&utmu=D~ HTTP/1.1
User-Agent: Mozilla/5.0 (Macintosh; U; Intel Mac OS X 10.7; en-US; rv:1.9.2.27) Gecko/20120216 Firefox/3.6.27
Accept: image/png,image/*;q=0.8,*/*;q=0.5
Accept-Language: en-us,en;q=0.5
Accept-Encoding: gzip,deflate
Accept-Charset: ISO-8859-1,utf-8;q=0.7,*;q=0.7
Keep-Alive: 115
Connection: keep-alive

HTTP/1.1 200 OK
Date: Thu, 01 Mar 2012 23:42:00 GMT
Content-Length: 35
X-Content-Type-Options: nosniff
Pragma: no-cache
Expires: Wed, 19 Apr 2000 11:43:00 GMT
Last-Modified: Wed, 21 Jan 2004 19:51:30 GMT
Content-Type: image/gif
Cache-Control: private, no-cache, no-cache=Set-Cookie, proxy-revalidate
Age: 157812
Server: GFE/2.0
----------------------------------------------------------

GET /consurf_logo.bmp HTTP/1.1
User-Agent: Mozilla/5.0 (Macintosh; U; Intel Mac OS X 10.7; en-US; rv:1.9.2.27) Gecko/20120216 Firefox/3.6.27
Accept: image/png,image/*;q=0.8,*/*;q=0.5
Accept-Language: en-us,en;q=0.5
Accept-Encoding: gzip,deflate
Accept-Charset: ISO-8859-1,utf-8;q=0.7,*;q=0.7
Keep-Alive: 115
Connection: keep-alive
Cookie: __utma=128144414.851853261.1330802995.1330802995.1330802995.1; __utmb=128144414.5.10.1330802995; __utmc=128144414; __utmz=128144414.1330802995.1.1.utmcsr=google|utmccn=(organic)|utmcmd=organic|utmctr=consurf
If-Modified-Since: Mon, 27 Aug 2007 16:38:05 GMT
If-None-Match: "604eb-53a96-438b0fb199540"
Cache-Control: max-age=0

HTTP/1.1 304 Not Modified
Date: Sat, 03 Mar 2012 19:32:13 GMT
Server: Apache/2.2.8 (EL)
Connection: close
Etag: "604eb-53a96-438b0fb199540"
----------------------------------------------------------

GET /safebrowsing/rd/ChNnb29nLW1hbHdhcmUtc2hhdmFyEAAYgasEIICwBCo4aRYBAP___________________________________________________________________wAyIoEVAQD______________________________________wA HTTP/1.1
User-Agent: Mozilla/5.0 (Macintosh; U; Intel Mac OS X 10.7; en-US; rv:1.9.2.27) Gecko/20120216 Firefox/3.6.27
Accept: text/html,application/xhtml+xml,application/xml;q=0.9,*/*;q=0.8
Accept-Language: en-us,en;q=0.5
Accept-Encoding: gzip,deflate
Accept-Charset: ISO-8859-1,utf-8;q=0.7,*;q=0.7
Keep-Alive: 115
Connection: keep-alive
Cookie: PREF=ID=ea5a9a1b579b2f90:U=6b6d71e20c67d066:TM=1330802864:LM=1330802866:S=8rg_a0YASysxY_vs; NID=57=HnC0Mttu-MpLiEjPqxXoomslWMffUHMCvMU1qW-F44MmgFtfjIFarMMmDv3HvAmgXSYE748BGydeZVMhw6ZlV75D4nuJTnT48zOn7sJt2vSDI_1TwLgD0aNng-Us_jWb; GuidedHelpResume=1663256:startNotSignedIn
Pragma: no-cache
Cache-Control: no-cache

HTTP/1.1 200 OK
Content-Type: application/vnd.google.safebrowsing-chunk
X-Content-Type-Options: nosniff
Date: Sat, 03 Mar 2012 19:28:40 GMT
Server: Chunked Update Server
Content-Length: 64507
X-XSS-Protection: 1; mode=block
X-Frame-Options: SAMEORIGIN
Cache-Control: public,max-age=172800
Age: 220
----------------------------------------------------------

GET /safebrowsing/rd/ChFnb29nLXBoaXNoLXNoYXZhchABGIHaBSCA5AUqJvhwAQD___________________________________________8BMoMBAW0BAP_______________________________9________f______________________________________________________________________________________________________________________________38 HTTP/1.1
User-Agent: Mozilla/5.0 (Macintosh; U; Intel Mac OS X 10.7; en-US; rv:1.9.2.27) Gecko/20120216 Firefox/3.6.27
Accept: text/html,application/xhtml+xml,application/xml;q=0.9,*/*;q=0.8
Accept-Language: en-us,en;q=0.5
Accept-Encoding: gzip,deflate
Accept-Charset: ISO-8859-1,utf-8;q=0.7,*;q=0.7
Keep-Alive: 115
Connection: keep-alive
Cookie: PREF=ID=ea5a9a1b579b2f90:U=6b6d71e20c67d066:TM=1330802864:LM=1330802866:S=8rg_a0YASysxY_vs; NID=57=HnC0Mttu-MpLiEjPqxXoomslWMffUHMCvMU1qW-F44MmgFtfjIFarMMmDv3HvAmgXSYE748BGydeZVMhw6ZlV75D4nuJTnT48zOn7sJt2vSDI_1TwLgD0aNng-Us_jWb; GuidedHelpResume=1663256:startNotSignedIn
Pragma: no-cache
Cache-Control: no-cache

HTTP/1.1 200 OK
Content-Type: application/vnd.google.safebrowsing-chunk
X-Content-Type-Options: nosniff
Date: Sat, 03 Mar 2012 19:28:43 GMT
Server: Chunked Update Server
Content-Length: 61064
X-XSS-Protection: 1; mode=block
X-Frame-Options: SAMEORIGIN
Cache-Control: public,max-age=172800
Age: 217
----------------------------------------------------------

GET /safebrowsing/rd/ChFnb29nLXBoaXNoLXNoYXZhchAAGIGnDCDAqQwyLYETAwD______________-______________________________________AA HTTP/1.1
User-Agent: Mozilla/5.0 (Macintosh; U; Intel Mac OS X 10.7; en-US; rv:1.9.2.27) Gecko/20120216 Firefox/3.6.27
Accept: text/html,application/xhtml+xml,application/xml;q=0.9,*/*;q=0.8
Accept-Language: en-us,en;q=0.5
Accept-Encoding: gzip,deflate
Accept-Charset: ISO-8859-1,utf-8;q=0.7,*;q=0.7
Keep-Alive: 115
Connection: keep-alive
Cookie: PREF=ID=ea5a9a1b579b2f90:U=6b6d71e20c67d066:TM=1330802864:LM=1330802866:S=8rg_a0YASysxY_vs; NID=57=HnC0Mttu-MpLiEjPqxXoomslWMffUHMCvMU1qW-F44MmgFtfjIFarMMmDv3HvAmgXSYE748BGydeZVMhw6ZlV75D4nuJTnT48zOn7sJt2vSDI_1TwLgD0aNng-Us_jWb; GuidedHelpResume=1663256:startNotSignedIn
Pragma: no-cache
Cache-Control: no-cache

HTTP/1.1 200 OK
Content-Type: application/vnd.google.safebrowsing-chunk
X-Content-Type-Options: nosniff
Date: Sat, 03 Mar 2012 13:36:53 GMT
Server: Chunked Update Server
Content-Length: 94803
X-XSS-Protection: 1; mode=block
X-Frame-Options: SAMEORIGIN
Cache-Control: public,max-age=172800
Age: 21327
----------------------------------------------------------

GET /safebrowsing/rd/ChFnb29nLXBoaXNoLXNoYXZhchAAGMGpDCCArAwyLcEUAwD_____________________________________________________AA HTTP/1.1
User-Agent: Mozilla/5.0 (Macintosh; U; Intel Mac OS X 10.7; en-US; rv:1.9.2.27) Gecko/20120216 Firefox/3.6.27
Accept: text/html,application/xhtml+xml,application/xml;q=0.9,*/*;q=0.8
Accept-Language: en-us,en;q=0.5
Accept-Encoding: gzip,deflate
Accept-Charset: ISO-8859-1,utf-8;q=0.7,*;q=0.7
Keep-Alive: 115
Connection: keep-alive
Cookie: PREF=ID=ea5a9a1b579b2f90:U=6b6d71e20c67d066:TM=1330802864:LM=1330802866:S=8rg_a0YASysxY_vs; NID=57=HnC0Mttu-MpLiEjPqxXoomslWMffUHMCvMU1qW-F44MmgFtfjIFarMMmDv3HvAmgXSYE748BGydeZVMhw6ZlV75D4nuJTnT48zOn7sJt2vSDI_1TwLgD0aNng-Us_jWb; GuidedHelpResume=1663256:startNotSignedIn
Pragma: no-cache
Cache-Control: no-cache

HTTP/1.1 200 OK
Content-Type: application/vnd.google.safebrowsing-chunk
X-Content-Type-Options: nosniff
Date: Sat, 03 Mar 2012 13:36:17 GMT
Server: Chunked Update Server
Content-Length: 110783
X-XSS-Protection: 1; mode=block
X-Frame-Options: SAMEORIGIN
Cache-Control: public,max-age=172800
Age: 21363
----------------------------------------------------------

GET /safebrowsing/rd/ChFnb29nLXBoaXNoLXNoYXZhchAAGIGsDCDArgwyLQEWAwD_____________________________________________________AA HTTP/1.1
User-Agent: Mozilla/5.0 (Macintosh; U; Intel Mac OS X 10.7; en-US; rv:1.9.2.27) Gecko/20120216 Firefox/3.6.27
Accept: text/html,application/xhtml+xml,application/xml;q=0.9,*/*;q=0.8
Accept-Language: en-us,en;q=0.5
Accept-Encoding: gzip,deflate
Accept-Charset: ISO-8859-1,utf-8;q=0.7,*;q=0.7
Keep-Alive: 115
Connection: keep-alive
Cookie: PREF=ID=ea5a9a1b579b2f90:U=6b6d71e20c67d066:TM=1330802864:LM=1330802866:S=8rg_a0YASysxY_vs; NID=57=HnC0Mttu-MpLiEjPqxXoomslWMffUHMCvMU1qW-F44MmgFtfjIFarMMmDv3HvAmgXSYE748BGydeZVMhw6ZlV75D4nuJTnT48zOn7sJt2vSDI_1TwLgD0aNng-Us_jWb; GuidedHelpResume=1663256:startNotSignedIn
Pragma: no-cache
Cache-Control: no-cache

HTTP/1.1 200 OK
Content-Type: application/vnd.google.safebrowsing-chunk
X-Content-Type-Options: nosniff
Date: Fri, 02 Mar 2012 18:44:20 GMT
Server: Chunked Update Server
Content-Length: 112762
X-XSS-Protection: 1; mode=block
X-Frame-Options: SAMEORIGIN
Cache-Control: public,max-age=172800
Age: 89281
----------------------------------------------------------

GET /safebrowsing/rd/ChFnb29nLXBoaXNoLXNoYXZhchAAGMGuDCCAsQwyLUEXAwD_____________________________________________________AA HTTP/1.1
User-Agent: Mozilla/5.0 (Macintosh; U; Intel Mac OS X 10.7; en-US; rv:1.9.2.27) Gecko/20120216 Firefox/3.6.27
Accept: text/html,application/xhtml+xml,application/xml;q=0.9,*/*;q=0.8
Accept-Language: en-us,en;q=0.5
Accept-Encoding: gzip,deflate
Accept-Charset: ISO-8859-1,utf-8;q=0.7,*;q=0.7
Keep-Alive: 115
Connection: keep-alive
Cookie: PREF=ID=ea5a9a1b579b2f90:U=6b6d71e20c67d066:TM=1330802864:LM=1330802866:S=8rg_a0YASysxY_vs; NID=57=HnC0Mttu-MpLiEjPqxXoomslWMffUHMCvMU1qW-F44MmgFtfjIFarMMmDv3HvAmgXSYE748BGydeZVMhw6ZlV75D4nuJTnT48zOn7sJt2vSDI_1TwLgD0aNng-Us_jWb; GuidedHelpResume=1663256:startNotSignedIn
Pragma: no-cache
Cache-Control: no-cache

HTTP/1.1 200 OK
Content-Type: application/vnd.google.safebrowsing-chunk
X-Content-Type-Options: nosniff
Date: Sat, 03 Mar 2012 13:20:11 GMT
Server: Chunked Update Server
Content-Length: 118923
X-XSS-Protection: 1; mode=block
X-Frame-Options: SAMEORIGIN
Cache-Control: public,max-age=172800
Age: 22330
----------------------------------------------------------

GET /safebrowsing/rd/ChFnb29nLXBoaXNoLXNoYXZhchAAGIGxDCCAtgwqUaEYAwD_____________________________________________________________________________________________________ADIJgRgDAP____8A HTTP/1.1
User-Agent: Mozilla/5.0 (Macintosh; U; Intel Mac OS X 10.7; en-US; rv:1.9.2.27) Gecko/20120216 Firefox/3.6.27
Accept: text/html,application/xhtml+xml,application/xml;q=0.9,*/*;q=0.8
Accept-Language: en-us,en;q=0.5
Accept-Encoding: gzip,deflate
Accept-Charset: ISO-8859-1,utf-8;q=0.7,*;q=0.7
Keep-Alive: 115
Connection: keep-alive
Cookie: PREF=ID=ea5a9a1b579b2f90:U=6b6d71e20c67d066:TM=1330802864:LM=1330802866:S=8rg_a0YASysxY_vs; NID=57=HnC0Mttu-MpLiEjPqxXoomslWMffUHMCvMU1qW-F44MmgFtfjIFarMMmDv3HvAmgXSYE748BGydeZVMhw6ZlV75D4nuJTnT48zOn7sJt2vSDI_1TwLgD0aNng-Us_jWb; GuidedHelpResume=1663256:startNotSignedIn
Pragma: no-cache
Cache-Control: no-cache

HTTP/1.1 200 OK
Content-Type: application/vnd.google.safebrowsing-chunk
X-Content-Type-Options: nosniff
Date: Sat, 03 Mar 2012 19:28:40 GMT
Server: Chunked Update Server
Content-Length: 14627
X-XSS-Protection: 1; mode=block
X-Frame-Options: SAMEORIGIN
Cache-Control: public,max-age=172800
Age: 222
----------------------------------------------------------

GET /results/1330803099/output.php HTTP/1.1
User-Agent: Mozilla/5.0 (Macintosh; U; Intel Mac OS X 10.7; en-US; rv:1.9.2.27) Gecko/20120216 Firefox/3.6.27
Accept: text/html,application/xhtml+xml,application/xml;q=0.9,*/*;q=0.8
Accept-Language: en-us,en;q=0.5
Accept-Encoding: gzip,deflate
Accept-Charset: ISO-8859-1,utf-8;q=0.7,*;q=0.7
Keep-Alive: 115
Connection: keep-alive
Cookie: __utma=128144414.851853261.1330802995.1330802995.1330802995.1; __utmb=128144414.5.10.1330802995; __utmc=128144414; __utmz=128144414.1330802995.1.1.utmcsr=google|utmccn=(organic)|utmcmd=organic|utmctr=consurf
Cache-Control: max-age=0

HTTP/1.1 200 OK
Date: Sat, 03 Mar 2012 19:32:43 GMT
Server: Apache/2.2.8 (EL)
X-Powered-By: PHP/5.1.6
Content-Length: 4554
Connection: close
Content-Type: text/html; charset=UTF-8
----------------------------------------------------------

GET /javascript_functions.js HTTP/1.1
User-Agent: Mozilla/5.0 (Macintosh; U; Intel Mac OS X 10.7; en-US; rv:1.9.2.27) Gecko/20120216 Firefox/3.6.27
Accept: */*
Accept-Language: en-us,en;q=0.5
Accept-Encoding: gzip,deflate
Accept-Charset: ISO-8859-1,utf-8;q=0.7,*;q=0.7
Keep-Alive: 115
Connection: keep-alive
Cookie: __utma=128144414.851853261.1330802995.1330802995.1330802995.1; __utmb=128144414.5.10.1330802995; __utmc=128144414; __utmz=128144414.1330802995.1.1.utmcsr=google|utmccn=(organic)|utmcmd=organic|utmctr=consurf
If-Modified-Since: Wed, 25 Jan 2012 10:51:11 GMT
If-None-Match: "68073-4d74-4b7580aada5c0"
Cache-Control: max-age=0

HTTP/1.1 304 Not Modified
Date: Sat, 03 Mar 2012 19:32:44 GMT
Server: Apache/2.2.8 (EL)
Connection: close
Etag: "68073-4d74-4b7580aada5c0"
----------------------------------------------------------

GET /text_8_7.css HTTP/1.1
User-Agent: Mozilla/5.0 (Macintosh; U; Intel Mac OS X 10.7; en-US; rv:1.9.2.27) Gecko/20120216 Firefox/3.6.27
Accept: text/css,*/*;q=0.1
Accept-Language: en-us,en;q=0.5
Accept-Encoding: gzip,deflate
Accept-Charset: ISO-8859-1,utf-8;q=0.7,*;q=0.7
Keep-Alive: 115
Connection: keep-alive
Cookie: __utma=128144414.851853261.1330802995.1330802995.1330802995.1; __utmb=128144414.5.10.1330802995; __utmc=128144414; __utmz=128144414.1330802995.1.1.utmcsr=google|utmccn=(organic)|utmcmd=organic|utmctr=consurf
If-Modified-Since: Wed, 25 Jan 2012 10:51:13 GMT
If-None-Match: "680d7-f19-4b7580acc2a40"
Cache-Control: max-age=0

HTTP/1.1 304 Not Modified
Date: Sat, 03 Mar 2012 19:32:44 GMT
Server: Apache/2.2.8 (EL)
Connection: close
Etag: "680d7-f19-4b7580acc2a40"
----------------------------------------------------------

GET /ga.js HTTP/1.1
User-Agent: Mozilla/5.0 (Macintosh; U; Intel Mac OS X 10.7; en-US; rv:1.9.2.27) Gecko/20120216 Firefox/3.6.27
Accept: */*
Accept-Language: en-us,en;q=0.5
Accept-Encoding: gzip,deflate
Accept-Charset: ISO-8859-1,utf-8;q=0.7,*;q=0.7
Keep-Alive: 115
Connection: keep-alive
If-Modified-Since: Thu, 16 Feb 2012 00:48:45 GMT
Cache-Control: max-age=0

HTTP/1.1 304 Not Modified
Date: Sat, 03 Mar 2012 17:42:01 GMT
Expires: Sat, 03 Mar 2012 19:42:01 GMT
Age: 6643
Server: GFE/2.0
----------------------------------------------------------

GET /__utm.gif?utmwv=5.2.5&utms=6&utmn=147250340&utmhn=consurf.tau.ac.il&utmcs=UTF-8&utmsr=1280x800&utmvp=994x637&utmsc=24-bit&utmul=en-us&utmje=1&utmfl=10.3%20r183&utmdt=ConSurf%20run%20no.%201330803099%20no%20PDB&utmhid=1072563392&utmr=-&utmp=%2Fresults%2F1330803099%2Foutput.php&utmac=UA-12265767-3&utmcc=__utma%3D128144414.851853261.1330802995.1330802995.1330802995.1%3B%2B__utmz%3D128144414.1330802995.1.1.utmcsr%3Dgoogle%7Cutmccn%3D(organic)%7Cutmcmd%3Dorganic%7Cutmctr%3Dconsurf%3B&utmu=D~ HTTP/1.1
User-Agent: Mozilla/5.0 (Macintosh; U; Intel Mac OS X 10.7; en-US; rv:1.9.2.27) Gecko/20120216 Firefox/3.6.27
Accept: image/png,image/*;q=0.8,*/*;q=0.5
Accept-Language: en-us,en;q=0.5
Accept-Encoding: gzip,deflate
Accept-Charset: ISO-8859-1,utf-8;q=0.7,*;q=0.7
Keep-Alive: 115
Connection: keep-alive

HTTP/1.1 200 OK
Date: Thu, 01 Mar 2012 23:42:00 GMT
Content-Length: 35
X-Content-Type-Options: nosniff
Pragma: no-cache
Expires: Wed, 19 Apr 2000 11:43:00 GMT
Last-Modified: Wed, 21 Jan 2004 19:51:30 GMT
Content-Type: image/gif
Cache-Control: private, no-cache, no-cache=Set-Cookie, proxy-revalidate
Age: 157844
Server: GFE/2.0
----------------------------------------------------------

GET /consurf_logo.bmp HTTP/1.1
User-Agent: Mozilla/5.0 (Macintosh; U; Intel Mac OS X 10.7; en-US; rv:1.9.2.27) Gecko/20120216 Firefox/3.6.27
Accept: image/png,image/*;q=0.8,*/*;q=0.5
Accept-Language: en-us,en;q=0.5
Accept-Encoding: gzip,deflate
Accept-Charset: ISO-8859-1,utf-8;q=0.7,*;q=0.7
Keep-Alive: 115
Connection: keep-alive
Cookie: __utma=128144414.851853261.1330802995.1330802995.1330802995.1; __utmb=128144414.6.10.1330802995; __utmc=128144414; __utmz=128144414.1330802995.1.1.utmcsr=google|utmccn=(organic)|utmcmd=organic|utmctr=consurf
If-Modified-Since: Mon, 27 Aug 2007 16:38:05 GMT
If-None-Match: "604eb-53a96-438b0fb199540"
Cache-Control: max-age=0

HTTP/1.1 304 Not Modified
Date: Sat, 03 Mar 2012 19:32:45 GMT
Server: Apache/2.2.8 (EL)
Connection: close
Etag: "604eb-53a96-438b0fb199540"
----------------------------------------------------------

GET /results/1330803099/output.php HTTP/1.1
User-Agent: Mozilla/5.0 (Macintosh; U; Intel Mac OS X 10.7; en-US; rv:1.9.2.27) Gecko/20120216 Firefox/3.6.27
Accept: text/html,application/xhtml+xml,application/xml;q=0.9,*/*;q=0.8
Accept-Language: en-us,en;q=0.5
Accept-Encoding: gzip,deflate
Accept-Charset: ISO-8859-1,utf-8;q=0.7,*;q=0.7
Keep-Alive: 115
Connection: keep-alive
Cookie: __utma=128144414.851853261.1330802995.1330802995.1330802995.1; __utmb=128144414.6.10.1330802995; __utmc=128144414; __utmz=128144414.1330802995.1.1.utmcsr=google|utmccn=(organic)|utmcmd=organic|utmctr=consurf
Cache-Control: max-age=0

HTTP/1.1 200 OK
Date: Sat, 03 Mar 2012 19:33:15 GMT
Server: Apache/2.2.8 (EL)
X-Powered-By: PHP/5.1.6
Connection: close
Transfer-Encoding: chunked
Content-Type: text/html; charset=UTF-8
----------------------------------------------------------

GET /clmenu.css HTTP/1.1
User-Agent: Mozilla/5.0 (Macintosh; U; Intel Mac OS X 10.7; en-US; rv:1.9.2.27) Gecko/20120216 Firefox/3.6.27
Accept: text/css,*/*;q=0.1
Accept-Language: en-us,en;q=0.5
Accept-Encoding: gzip,deflate
Accept-Charset: ISO-8859-1,utf-8;q=0.7,*;q=0.7
Keep-Alive: 115
Connection: keep-alive
Cookie: __utma=128144414.851853261.1330802995.1330802995.1330802995.1; __utmb=128144414.6.10.1330802995; __utmc=128144414; __utmz=128144414.1330802995.1.1.utmcsr=google|utmccn=(organic)|utmcmd=organic|utmctr=consurf

HTTP/1.1 200 OK
Date: Sat, 03 Mar 2012 19:33:16 GMT
Server: Apache/2.2.8 (EL)
Last-Modified: Wed, 26 Aug 2009 14:27:51 GMT
Etag: "602fb-128-4720c418127c0"
Accept-Ranges: bytes
Content-Length: 296
Connection: close
Content-Type: text/css
----------------------------------------------------------

GET /javascript_functions.js HTTP/1.1
User-Agent: Mozilla/5.0 (Macintosh; U; Intel Mac OS X 10.7; en-US; rv:1.9.2.27) Gecko/20120216 Firefox/3.6.27
Accept: */*
Accept-Language: en-us,en;q=0.5
Accept-Encoding: gzip,deflate
Accept-Charset: ISO-8859-1,utf-8;q=0.7,*;q=0.7
Keep-Alive: 115
Connection: keep-alive
Cookie: __utma=128144414.851853261.1330802995.1330802995.1330802995.1; __utmb=128144414.6.10.1330802995; __utmc=128144414; __utmz=128144414.1330802995.1.1.utmcsr=google|utmccn=(organic)|utmcmd=organic|utmctr=consurf
If-Modified-Since: Wed, 25 Jan 2012 10:51:11 GMT
If-None-Match: "68073-4d74-4b7580aada5c0"
Cache-Control: max-age=0

HTTP/1.1 304 Not Modified
Date: Sat, 03 Mar 2012 19:33:16 GMT
Server: Apache/2.2.8 (EL)
Connection: close
Etag: "68073-4d74-4b7580aada5c0"
----------------------------------------------------------

GET /clmenu.js HTTP/1.1
User-Agent: Mozilla/5.0 (Macintosh; U; Intel Mac OS X 10.7; en-US; rv:1.9.2.27) Gecko/20120216 Firefox/3.6.27
Accept: */*
Accept-Language: en-us,en;q=0.5
Accept-Encoding: gzip,deflate
Accept-Charset: ISO-8859-1,utf-8;q=0.7,*;q=0.7
Keep-Alive: 115
Connection: keep-alive
Cookie: __utma=128144414.851853261.1330802995.1330802995.1330802995.1; __utmb=128144414.6.10.1330802995; __utmc=128144414; __utmz=128144414.1330802995.1.1.utmcsr=google|utmccn=(organic)|utmcmd=organic|utmctr=consurf

HTTP/1.1 200 OK
Date: Sat, 03 Mar 2012 19:33:16 GMT
Server: Apache/2.2.8 (EL)
Last-Modified: Thu, 13 Aug 2009 12:31:33 GMT
Etag: "602e0-892-471051da57340"
Accept-Ranges: bytes
Content-Length: 2194
Connection: close
Content-Type: application/x-javascript
----------------------------------------------------------

GET /text_8_7.css HTTP/1.1
User-Agent: Mozilla/5.0 (Macintosh; U; Intel Mac OS X 10.7; en-US; rv:1.9.2.27) Gecko/20120216 Firefox/3.6.27
Accept: text/css,*/*;q=0.1
Accept-Language: en-us,en;q=0.5
Accept-Encoding: gzip,deflate
Accept-Charset: ISO-8859-1,utf-8;q=0.7,*;q=0.7
Keep-Alive: 115
Connection: keep-alive
Cookie: __utma=128144414.851853261.1330802995.1330802995.1330802995.1; __utmb=128144414.6.10.1330802995; __utmc=128144414; __utmz=128144414.1330802995.1.1.utmcsr=google|utmccn=(organic)|utmcmd=organic|utmctr=consurf
If-Modified-Since: Wed, 25 Jan 2012 10:51:13 GMT
If-None-Match: "680d7-f19-4b7580acc2a40"
Cache-Control: max-age=0

HTTP/1.1 304 Not Modified
Date: Sat, 03 Mar 2012 19:33:16 GMT
Server: Apache/2.2.8 (EL)
Connection: close
Etag: "680d7-f19-4b7580acc2a40"
----------------------------------------------------------

GET /consurf_logo.bmp HTTP/1.1
User-Agent: Mozilla/5.0 (Macintosh; U; Intel Mac OS X 10.7; en-US; rv:1.9.2.27) Gecko/20120216 Firefox/3.6.27
Accept: image/png,image/*;q=0.8,*/*;q=0.5
Accept-Language: en-us,en;q=0.5
Accept-Encoding: gzip,deflate
Accept-Charset: ISO-8859-1,utf-8;q=0.7,*;q=0.7
Keep-Alive: 115
Connection: keep-alive
Cookie: __utma=128144414.851853261.1330802995.1330802995.1330802995.1; __utmb=128144414.6.10.1330802995; __utmc=128144414; __utmz=128144414.1330802995.1.1.utmcsr=google|utmccn=(organic)|utmcmd=organic|utmctr=consurf
If-Modified-Since: Mon, 27 Aug 2007 16:38:05 GMT
If-None-Match: "604eb-53a96-438b0fb199540"
Cache-Control: max-age=0

HTTP/1.1 304 Not Modified
Date: Sat, 03 Mar 2012 19:33:17 GMT
Server: Apache/2.2.8 (EL)
Connection: close
Etag: "604eb-53a96-438b0fb199540"
----------------------------------------------------------


On Sat, Mar 3, 2012 at 11:01 AM, Shane Neeley <shane.neeley <at> gmail.com> wrote:
Hi,

Please bare with me, I am new to both cURL and HTML. I have an interesting problem and I would like to be able to use cURL to solve it. I am trying to access a server located here: 

http://consurf.tau.ac.il/index_full_form_PROT.php

I will write a python program that will use cURL to add text to the box that says "Paste protein sequence here"
Then all I need to do is press the submit button at the bottom. I am trying to automate this process over thousands of files and I heard that cURL might be a great way to do it. 

Here would be an example of the FASTA format in quotes that it is talking about.
">
DGVGSSSGNWHCDSTWLGDRVITTSTRTWALPTYNNHLYKQISNGTSGGATNDNTYFGYST"

Could somebody please show me how I could fill out that form using cURL in my terminal? Thank you sincerely.

Shane.

-------------------------------------------------------------------
List admin: http://cool.haxx.se/list/listinfo/curl-users
FAQ:        http://curl.haxx.se/docs/faq.html
Etiquette:  http://curl.haxx.se/mail/etiquette.html
Shane Neeley | 4 Mar 2012 00:48
Picon

Installing libcurl and pycurl

Hi Curl Network!


I have Mac OS X 10.7 and I want to install libcurl so that I can install pycurl. 

Could anybody help walk me through this?

Thanks
-------------------------------------------------------------------
List admin: http://cool.haxx.se/list/listinfo/curl-users
FAQ:        http://curl.haxx.se/docs/faq.html
Etiquette:  http://curl.haxx.se/mail/etiquette.html
Her | 4 Mar 2012 10:27
Picon

Help: "User was rejected by the SOCKS5 server "

hi,

I come cross this problem many days,and setup 2 proxy server,but have
the same problem:User was rejected by the SOCKS5 server

I installed Socks5 and antinat ,but get the same problem,i really
don't know how to resolve this(i googled ,but nothing ).so pls help me
to resolve this problem,thank you very much.

my socks info(all are antinat default,i didn't change anything):
149.255.103.177 1080
testuser testpass

Kind Regards
Qin
-------------------------------------------------------------------
List admin: http://cool.haxx.se/list/listinfo/curl-users
FAQ:        http://curl.haxx.se/docs/faq.html
Etiquette:  http://curl.haxx.se/mail/etiquette.html

Daniel Stenberg | 4 Mar 2012 22:44
Picon
Favicon
Gravatar

Re: Fwd: Curl - 7.21.5 HTTP Request Cancelation

On Mon, 27 Feb 2012, Khaled Zayed wrote:

> I mean that I am sending HTTP requests to fetch some data segments. Is it 
> possible to cancel the request after sending it ?

The curl tool has no such ability, no. With libcurl you have at least the 
chance to abort without waiting for the (full) response.

But before you ask anything else, do read up on the mailing list etiquette.

--

-- 

  / daniel.haxx.se
-------------------------------------------------------------------
List admin: http://cool.haxx.se/list/listinfo/curl-users
FAQ:        http://curl.haxx.se/docs/faq.html
Etiquette:  http://curl.haxx.se/mail/etiquette.html

Daniel Stenberg | 4 Mar 2012 23:18
Picon
Favicon
Gravatar

Re: Forcing curl to use gssapi

On Fri, 2 Mar 2012, Michael B. Klein wrote:

> I've compiled curl with both libssl2 and gssapi support, but I can't seem to 
> get curl to attempt gssapi authentication.
>
> Here's my (verbose) output:
>
> dn0a20734e:lyber-core mbklein$ curl-ssh --verbose sftp://myuser <at> myserver
> /var/opt/home/myuser/testfile.txt

...

> Am I doing something wrong, or is SFTP+GSSAPI/Kerberos simply not a
> supported protocol/auth combination?

You guessed it. The GSS support is only there for HTTP and to some extent FTP, 
but for SFTP it would have to be supported by libssh2 which does all the SSH 
magic and it just doesn't support it.

If you feel like working on it making it happen, then please roll up your 
sleeves and join the libssh2-devel mailing list and discuss further on how to 
make this reality.

--

-- 

  / daniel.haxx.se
-------------------------------------------------------------------
List admin: http://cool.haxx.se/list/listinfo/curl-users
FAQ:        http://curl.haxx.se/docs/faq.html
Etiquette:  http://curl.haxx.se/mail/etiquette.html

Daniel Stenberg | 4 Mar 2012 23:28
Picon
Favicon
Gravatar

Re: Help: "User was rejected by the SOCKS5 server "

On Sun, 4 Mar 2012, Her wrote:

> I come cross this problem many days,and setup 2 proxy server,but have
> the same problem:User was rejected by the SOCKS5 server

That means your proxy rejected curl's request to setup a connection through 
it.

The two additional numbers it output after that text give additional info, as 
the second of those pinpoints the exact reason (which isn't clear without 
reading the code or the SOCKS5 spec but still...).

Guessing wildly, I'd say you're either using bad credentials or your proxy 
wants another authentication mechanism than what curl supports for SOCKS5.

--

-- 

  / daniel.haxx.se
-------------------------------------------------------------------
List admin: http://cool.haxx.se/list/listinfo/curl-users
FAQ:        http://curl.haxx.se/docs/faq.html
Etiquette:  http://curl.haxx.se/mail/etiquette.html


Gmane